* chain 0: NIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRDEGKTYCMQF. PDBModel.report() gives you a more useful overview: What, for instance, are those + and ~ characters? Do we have one or two DNA strands? ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~'Īpparently, we are looking at a pretty large structure here! First comes a protein sequence (upper case letters) followed by a stretch of DNA residues (lower case).
PYLIPQMMYKLPacgctagggataacagggtaatacgtattaccctgttatccctagcgtacgctagggataacagggtaatacgta NLVENYLTPMSLAYWFMDDGGKWDYNKNSTNKSIVLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYIDSMSYLIFYNLIK LILGDAYIRSRDEGKTYCMQFEWKNKAYMDHVCLLYDQWVLSPPHKKERVNHLGNLVITWGAQTFKHQAFNKLANLFIVNNKKTIPN VKGLRNKFQLNCYVKINKNKPIIYIDSMSYLIFYNLIKPYLIPQMMYKLPNIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIG VNHLGNLVITWGAQTFKHQAFNKLANLFIVNNKKTIPNNLVENYLTPMSLAYWFMDDGGKWDYNKNSTNKSIVLNTQSFTFEEVEYL 'NIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRDEGKTYCMQFEWKNKAYMDHVCLLYDQWVLSPPHKKER Now, let's see what we can do with this PDBModel thing! First we want to have a look at the sequence: The second line creates a new instance of PDBModel and loads the example PDB file into it. For interactive work it is acceptable though. Warning: you should never use 'import *' in your own python programs. The first line imports all published Biskit classes, including PDBModel. Open an interactive python shell (type python or open the python file in emacs and start a new interpreter) and execute the following:
0 kommentar(er)
